![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (4 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.1: ATP-dependent DNA ligase catalytic domain [56092] (2 proteins) |
![]() | Protein ATP-dependent DNA ligase, N-terminal domain [56093] (2 species) |
![]() | Species Chlorella virus, PBCV-1 [56095] (2 PDB entries) |
![]() | Domain d1p8la2: 1p8l A:2-189 [94364] Other proteins in same PDB: d1p8la1 complexed with amp |
PDB Entry: 1p8l (more details), 2.95 Å
SCOP Domain Sequences for d1p8la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p8la2 d.142.2.1 (A:2-189) ATP-dependent DNA ligase, N-terminal domain {Chlorella virus, PBCV-1} aitkpllaatleniedvqfpclatpkidgirsvkqtqmlsrtfkpirnsvmnrlltellp egsdgeisiegatfqdttsavmtghkmynakfsyywfdyvtddplkkyidrvedmknyit vhphilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstlke gillkmkq
Timeline for d1p8la2: