Lineage for d1p8la1 (1p8l A:190-297)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.40: OB-fold [50198] (10 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) 
Family b.40.4.6: DNA ligase/mRNA capping enzyme, domain 2 [50307] (4 proteins) Protein ATP-dependent DNA ligase [50310] (2 species) Species Chlorella virus, PBCV-1 [50312] (2 PDB entries) 
Domain d1p8la1: 1p8l A:190-297 [94363]
Other proteins in same PDB: d1p8la2
Details for d1p8la1
PDB Entry: 1p8l (more details), 2.95 Å
PDB Description: New Crystal Structure of Chlorella Virus DNA Ligase-Adenylate
SCOP Domain Sequences for d1p8la1:
Sequence, based on SEQRES records: (download)
>d1p8la1 b.40.4.6 (A:190-297) ATP-dependent DNA ligase {Chlorella virus, PBCV-1}
fkdaeatiismtalfkntntktkdnfgyskrsthksgkveedvmgsievdydgvvfsigt
gfdadqrrdfwqnkesyigkmvkfkyfemgskdcprfpvfigirheed
Sequence, based on observed residues (ATOM records): (download)
>d1p8la1 b.40.4.6 (A:190-297) ATP-dependent DNA ligase {Chlorella virus, PBCV-1}
fkdaeatiismtalfknfgyedvmgsievdydgvvfsigtgfdadqrrdfwqnkesyigk
mvkfkyfemgskdcprfpvfigirheed
SCOP Domain Coordinates for d1p8la1:
Click to download the PDB-style file with coordinates for d1p8la1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p8la1:
- d1p8la1 first appeared in SCOP 1.67
- d1p8la1 appears in SCOP 1.71
- d1p8la1 appears in the current release, SCOPe 2.08
View in 3D
