Lineage for d1p8kz2 (1p8k Z:126-254)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608385Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 608392Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 608393Family d.95.2.1: Group I mobile intron endonuclease [55609] (5 proteins)
    contains two extra helices in the C-terminal extension
  6. 608394Protein DNA endonuclease I-AniI [103141] (1 species)
    duplication: contains tandem repeat of this fold
  7. 608395Species Aspergillus nidulans [TaxId:162425] [103142] (1 PDB entry)
    synonym: Emericella nidulans
  8. 608397Domain d1p8kz2: 1p8k Z:126-254 [94362]
    complexed with mg

Details for d1p8kz2

PDB Entry: 1p8k (more details), 2.6 Å

PDB Description: The structure and DNA recognition of a bifunctional homing endonuclease and group I intron splicing factor

SCOP Domain Sequences for d1p8kz2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8kz2 d.95.2.1 (Z:126-254) DNA endonuclease I-AniI {Aspergillus nidulans}
nsiesiintsyfsawlvgfieaegcfsvyklnkdddyliasfdiaqrdgdilisairkyl
sfttkvyldktncsklkvtsvrsveniikflqnapvkllgnkklqyllwlkqlrkisrys
ekikipsny

SCOP Domain Coordinates for d1p8kz2:

Click to download the PDB-style file with coordinates for d1p8kz2.
(The format of our PDB-style files is described here.)

Timeline for d1p8kz2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p8kz1