SCOP 1.71: Domain d1p8kz1: 1p8k Z:1-125

Lineage for d1p8kz1 (1p8k Z:1-125)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (2 families)

5. Family d.95.2.1: Group I mobile intron endonuclease [55609] (5 proteins)
   contains two extra helices in the C-terminal extension

6. Protein DNA endonuclease I-AniI [103141] (1 species)
   duplication: contains tandem repeat of this fold

7. Species Aspergillus nidulans [TaxId:162425] [103142] (1 PDB entry)
   synonym: Emericella nidulans

8. Domain d1p8kz1: 1p8k Z:1-125 [94361]

Details for d1p8kz1

PDB Entry: 1p8k, 2.6 Å

PDB Description: The structure and DNA recognition of a bifunctional homing endonuclease and group I intron splicing factor

SCOP Domain Sequences for d1p8kz1:

Sequence; same for both SEQRES and ATOM records:

>d1p8kz1 d.95.2.1 (Z:1-125) DNA endonuclease I-AniI {Aspergillus nidulans}
gsdltyaylvglfegdgyfsitkkgkyltyelgielsikdvqliykikkilgigivsfrk
rneiemvalrirdknhlksfilpifekypmfsnkqydylrfrnallsgiisledlpdytr
sdepl

Timeline for d1p8kz1:

• d1p8kz1 first appeared in SCOP 1.67
  
• d1p8kz1 appears in SCOP 1.69
  
• d1p8kz1 appears in SCOP 1.73
  
• d1p8kz1 appears in the current release, SCOPe 2.08