![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.95: Homing endonuclease-like [55603] (2 superfamilies) alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243 |
![]() | Superfamily d.95.2: Homing endonucleases [55608] (2 families) ![]() |
![]() | Family d.95.2.1: Group I mobile intron endonuclease [55609] (5 proteins) contains two extra helices in the C-terminal extension |
![]() | Protein DNA endonuclease I-AniI [103141] (1 species) duplication: contains tandem repeat of this fold |
![]() | Species Aspergillus nidulans [TaxId:162425] [103142] (1 PDB entry) synonym: Emericella nidulans |
![]() | Domain d1p8kz1: 1p8k Z:1-125 [94361] |
PDB Entry: 1p8k (more details), 2.6 Å
SCOP Domain Sequences for d1p8kz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p8kz1 d.95.2.1 (Z:1-125) DNA endonuclease I-AniI {Aspergillus nidulans} gsdltyaylvglfegdgyfsitkkgkyltyelgielsikdvqliykikkilgigivsfrk rneiemvalrirdknhlksfilpifekypmfsnkqydylrfrnallsgiisledlpdytr sdepl
Timeline for d1p8kz1: