Lineage for d1p8ga1 (1p8g A:1-69)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196856Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2196857Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2196902Protein Copper chaperone [55017] (3 species)
  7. 2196903Species Bacillus subtilis, CopZ [TaxId:1423] [69736] (2 PDB entries)
  8. 2196905Domain d1p8ga1: 1p8g A:1-69 [94360]
    Other proteins in same PDB: d1p8ga2

Details for d1p8ga1

PDB Entry: 1p8g (more details)

PDB Description: the solution structure of apo copz from bacillus subtilis
PDB Compounds: (A:) similar to mercuric transport protein

SCOPe Domain Sequences for d1p8ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8ga1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]}
meqktlqvegmscqhcvkavetsvgeldgvsavhvnleagkvdvsfdadkvsvkdiadai
edqgydvak

SCOPe Domain Coordinates for d1p8ga1:

Click to download the PDB-style file with coordinates for d1p8ga1.
(The format of our PDB-style files is described here.)

Timeline for d1p8ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p8ga2