Lineage for d1p8cf_ (1p8c F:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449822Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 449823Superfamily a.152.1: AhpD-like [69118] (2 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 449848Family a.152.1.2: Hypothetical protein TM1620 [101468] (1 protein)
    hexamer of single domain subunits
  6. 449849Protein Hypothetical protein TM1620 [101469] (1 species)
  7. 449850Species Thermotoga maritima [TaxId:243274] [101470] (2 PDB entries)
  8. 449862Domain d1p8cf_: 1p8c F: [94359]
    structural genomics; MCSG target APC4843

Details for d1p8cf_

PDB Entry: 1p8c (more details), 2.3 Å

PDB Description: Crystal structure of TM1620 (APC4843) from Thermotoga maritima

SCOP Domain Sequences for d1p8cf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8cf_ a.152.1.2 (F:) Hypothetical protein TM1620 {Thermotoga maritima}
eykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcdd
ciryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekng

SCOP Domain Coordinates for d1p8cf_:

Click to download the PDB-style file with coordinates for d1p8cf_.
(The format of our PDB-style files is described here.)

Timeline for d1p8cf_: