| Class a: All alpha proteins [46456] (218 folds) |
| Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
Superfamily a.152.1: AhpD-like [69118] (2 families) ![]() probable biological unit contains six domains of this fold arranged with 32 symmetry |
| Family a.152.1.2: Hypothetical protein TM1620 [101468] (1 protein) hexamer of single domain subunits |
| Protein Hypothetical protein TM1620 [101469] (1 species) |
| Species Thermotoga maritima [TaxId:243274] [101470] (2 PDB entries) |
| Domain d1p8ce_: 1p8c E: [94358] |
PDB Entry: 1p8c (more details), 2.3 Å
SCOP Domain Sequences for d1p8ce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p8ce_ a.152.1.2 (E:) Hypothetical protein TM1620 {Thermotoga maritima}
eykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcdd
ciryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekngetis
Timeline for d1p8ce_: