![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.152: AhpD-like [69117] (1 superfamily) multihelical; contains 4-helical bundle and 2-helical arm |
![]() | Superfamily a.152.1: AhpD-like [69118] (4 families) ![]() probable biological unit contains six domains of this fold arranged with 32 symmetry |
![]() | Family a.152.1.2: CMD-like [101468] (2 proteins) Pfam PF02627; hexamer of single-domain subunits |
![]() | Protein Hypothetical protein TM1620 [101469] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [101470] (2 PDB entries) Uniprot Q9X1V5 |
![]() | Domain d1p8cd_: 1p8c D: [94357] structural genomics; MCSG target APC4843 |
PDB Entry: 1p8c (more details), 2.3 Å
SCOPe Domain Sequences for d1p8cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p8cd_ a.152.1.2 (D:) Hypothetical protein TM1620 {Thermotoga maritima [TaxId: 2336]} eykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcdd ciryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekngeti
Timeline for d1p8cd_: