Lineage for d1p8cb_ (1p8c B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 361960Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 361961Superfamily a.152.1: AhpD-like [69118] (2 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 361986Family a.152.1.2: Hypothetical protein TM1620 [101468] (1 protein)
    hexamer of single domain subunits
  6. 361987Protein Hypothetical protein TM1620 [101469] (1 species)
  7. 361988Species Thermotoga maritima [TaxId:243274] [101470] (1 PDB entry)
  8. 361990Domain d1p8cb_: 1p8c B: [94355]

Details for d1p8cb_

PDB Entry: 1p8c (more details), 2.3 Å

PDB Description: Crystal structure of TM1620 (APC4843) from Thermotoga maritima

SCOP Domain Sequences for d1p8cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8cb_ a.152.1.2 (B:) Hypothetical protein TM1620 {Thermotoga maritima}
ykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddc
iryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekng

SCOP Domain Coordinates for d1p8cb_:

Click to download the PDB-style file with coordinates for d1p8cb_.
(The format of our PDB-style files is described here.)

Timeline for d1p8cb_: