SCOP 1.67: Domain d1p8ca_: 1p8c A:

Lineage for d1p8ca_ (1p8c A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.152: AhpD-like [69117] (1 superfamily)
   multihelical; contains 4-helical bundle and 2-helical arm

4. Superfamily a.152.1: AhpD-like [69118] (2 families)
   probable biological unit contains six domains of this fold arranged with 32 symmetry

5. Family a.152.1.2: Hypothetical protein TM1620 [101468] (1 protein)
   hexamer of single domain subunits

6. Protein Hypothetical protein TM1620 [101469] (1 species)

7. Species Thermotoga maritima [TaxId:243274] [101470] (1 PDB entry)

8. Domain d1p8ca_: 1p8c A: [94354]

Details for d1p8ca_

PDB Entry: 1p8c, 2.3 Å

PDB Description: Crystal structure of TM1620 (APC4843) from Thermotoga maritima

SCOP Domain Sequences for d1p8ca_:

Sequence; same for both SEQRES and ATOM records:

>d1p8ca_ a.152.1.2 (A:) Hypothetical protein TM1620 {Thermotoga maritima}
rrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddciryhlvr
cvqegasdeeifealdialvvggsiviphlrravgfleelremekngetis

Timeline for d1p8ca_:

• d1p8ca_ is new in SCOP 1.67
  
• d1p8ca_ appears in SCOP 1.69
  
• d1p8ca_ appears in the current release, SCOPe 2.08