![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.6: omega toxin-like [57059] (5 families) ![]() |
![]() | Family g.3.6.4: Albumin 1 [90134] (2 proteins) |
![]() | Protein Pab1, subunit b [103537] (1 species) insecticidal protein |
![]() | Species Garden pea (Pisum sativum) [TaxId:3888] [103538] (1 PDB entry) |
![]() | Domain d1p8ba_: 1p8b A: [94353] |
PDB Entry: 1p8b (more details)
SCOP Domain Sequences for d1p8ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p8ba_ g.3.6.4 (A:) Pab1, subunit b {Garden pea (Pisum sativum) [TaxId: 3888]} ascngvcspfemppcgtsacrcipvglvigycrnpsg
Timeline for d1p8ba_: