Lineage for d1p8ba_ (1p8b A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 621450Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 621658Superfamily g.3.6: omega toxin-like [57059] (5 families) (S)
  5. 621794Family g.3.6.4: Albumin 1 [90134] (2 proteins)
  6. 621798Protein Pab1, subunit b [103537] (1 species)
    insecticidal protein
  7. 621799Species Garden pea (Pisum sativum) [TaxId:3888] [103538] (1 PDB entry)
  8. 621800Domain d1p8ba_: 1p8b A: [94353]

Details for d1p8ba_

PDB Entry: 1p8b (more details)

PDB Description: solution structure of pa1b, a 37-amino acid insecticidal protein extracted from pea seeds (pisum sativum)

SCOP Domain Sequences for d1p8ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8ba_ g.3.6.4 (A:) Pab1, subunit b {Garden pea (Pisum sativum)}
ascngvcspfemppcgtsacrcipvglvigycrnpsg

SCOP Domain Coordinates for d1p8ba_:

Click to download the PDB-style file with coordinates for d1p8ba_.
(The format of our PDB-style files is described here.)

Timeline for d1p8ba_: