| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein) |
| Protein Catalase, C-terminal domain [52329] (1 species) |
| Species Escherichia coli, HPII [TaxId:562] [52330] (14 PDB entries) |
| Domain d1p80d1: 1p80 D:598-753 [94343] Other proteins in same PDB: d1p80a2, d1p80b2, d1p80c2, d1p80d2 |
PDB Entry: 1p80 (more details), 1.65 Å
SCOP Domain Sequences for d1p80d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p80d1 c.23.16.3 (D:598-753) Catalase, C-terminal domain {Escherichia coli, HPII}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa
Timeline for d1p80d1: