| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein) |
| Protein Catalase, C-terminal domain [52329] (2 species) |
| Species Escherichia coli, HPII [TaxId:562] [52330] (17 PDB entries) |
| Domain d1p7yd1: 1p7y D:598-753 [94327] Other proteins in same PDB: d1p7ya2, d1p7yb2, d1p7yc2, d1p7yd2 complexed with hem |
PDB Entry: 1p7y (more details), 2.4 Å
SCOPe Domain Sequences for d1p7yd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p7yd1 c.23.16.3 (D:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa
Timeline for d1p7yd1: