Lineage for d1p7yb1 (1p7y B:598-753)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579489Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 579661Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)
  6. 579662Protein Catalase, C-terminal domain [52329] (2 species)
  7. 579663Species Escherichia coli, HPII [TaxId:562] [52330] (14 PDB entries)
  8. 579709Domain d1p7yb1: 1p7y B:598-753 [94323]
    Other proteins in same PDB: d1p7ya2, d1p7yb2, d1p7yc2, d1p7yd2

Details for d1p7yb1

PDB Entry: 1p7y (more details), 2.4 Å

PDB Description: crystal structure of the d181a variant of catalase hpii from e. coli

SCOP Domain Sequences for d1p7yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7yb1 c.23.16.3 (B:598-753) Catalase, C-terminal domain {Escherichia coli, HPII}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOP Domain Coordinates for d1p7yb1:

Click to download the PDB-style file with coordinates for d1p7yb1.
(The format of our PDB-style files is described here.)

Timeline for d1p7yb1: