SCOP 1.67: Domain d1p7ya1: 1p7y A:598-753

Lineage for d1p7ya1 (1p7y A:598-753)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (5 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)

6. Protein Catalase, C-terminal domain [52329] (1 species)

7. Species Escherichia coli, HPII [TaxId:562] [52330] (14 PDB entries)

8. Domain d1p7ya1: 1p7y A:598-753 [94321]
   Other proteins in same PDB: d1p7ya2, d1p7yb2, d1p7yc2, d1p7yd2

Details for d1p7ya1

PDB Entry: 1p7y, 2.4 Å

PDB Description: crystal structure of the d181a variant of catalase hpii from e. coli

SCOP Domain Sequences for d1p7ya1:

Sequence; same for both SEQRES and ATOM records:

>d1p7ya1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d1p7ya1:

• d1p7ya1 is new in SCOP 1.67
  
• d1p7ya1 appears in SCOP 1.69
  
• d1p7ya1 appears in the current release, SCOPe 2.08