Lineage for d1p7ta_ (1p7t A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088435Superfamily c.1.13: Malate synthase G [51645] (1 family) (S)
  5. 2088436Family c.1.13.1: Malate synthase G [51646] (2 protein domains)
  6. 2088437Protein Malate synthase G [51647] (3 species)
    contains the insert of all-beta (sub)domain and the C-terminal extension of all-alpha (sub)domain
  7. 2088438Species Escherichia coli [TaxId:562] [51648] (4 PDB entries)
    Uniprot P37330 2-722 # NMR-derived model
  8. 2088440Domain d1p7ta_: 1p7t A: [94319]
    complexed with aco, mg, peg, pg4, pyr

Details for d1p7ta_

PDB Entry: 1p7t (more details), 1.95 Å

PDB Description: Structure of Escherichia coli malate synthase G:pyruvate:acetyl-Coenzyme A abortive ternary complex at 1.95 angstrom resolution
PDB Compounds: (A:) malate synthase g

SCOPe Domain Sequences for d1p7ta_:

Sequence, based on SEQRES records: (download)

>d1p7ta_ c.1.13.1 (A:) Malate synthase G {Escherichia coli [TaxId: 562]}
titqsrlridanfkrfvdeevlpgtgldaaafwrnfdeivhdlapenrqllaerdriqaa
ldewhrsnpgpvkdkaayksflrelgylvpqpervtvettgidseitsqagpqlvvpamn
aryalnaanarwgslydalygsdiipqegamvsgydpqrgeqviawvrrfldeslpleng
syqdvvafkvvdkqlriqlkngkettlrtpaqfvgyrgdaaaptcillknnglhielqid
angrigkddpahindviveaaistildcedsvaavdaedkillyrnllglmqgtlqekme
kngrqivrklnddrhytaadgseislhgrsllfirnvghlmtipviwdsegneipegild
gvmtgaialydlkvqknsrtgsvyivkpkmhgpqevafanklftrietmlgmapntlkmg
imdeerrtslnlrsciaqarnrvafintgfldrtgdemhsvmeagpmlrknqmkstpwik
ayernnvlsglfcglrgkaqigkgmwampdlmadmysqkgdqlragantawvpsptaatl
halhyhqtnvqsvqaniaqtefnaefepllddlltipvaenanwsaqeiqqeldnnvqgi
lgyvvrwveqgigcskvpdihnvalmedratlrissqhianwlrhgiltkeqvqaslenm
akvvdqqnagdpayrpmagnfanscafkaasdliflgvkqpngytepllhawrlrekes

Sequence, based on observed residues (ATOM records): (download)

>d1p7ta_ c.1.13.1 (A:) Malate synthase G {Escherichia coli [TaxId: 562]}
titqsrlridanfkrfvdeevlpgtgldaaafwrnfdeivhdlapenrqllaerdriqaa
ldewhrsnpgpvkdkaayksflrelgylvpqpervtvettgidseitsqagpqlvvpamn
aryalnaanarwgslydalygsdiipqdpqrgeqviawvrrfldeslplengsyqdvvaf
kvvdkqlriqlkngkettlrtpaqfvgyrgdaaaptcillknnglhielqidangrigkd
dpahindviveaaistildcedsvaavdaedkillyrnllglmqgtlqekmqivrklndd
rhytaadgseislhgrsllfirnvghlmtipviwdsegneipegildgvmtgaialydlk
vqknsrtgsvyivkpkmhgpqevafanklftrietmlgmapntlkmgimdeerrtslnlr
sciaqarnrvafintgfldrtgdemhsvmeagpmlrknqmkstpwikayernnvlsglfc
glrgkaqigkgmwampdlmadmysqkgdqlragantawvpsptaatlhalhyhqtnvqsv
qaniaqtefnaefepllddlltipvaenanwsaqeiqqeldnnvqgilgyvvrwveqgig
cskvpdihnvalmedratlrissqhianwlrhgiltkeqvqaslenmakvvdqqnagdpa
yrpmagnfanscafkaasdliflgvkqpngytepllhawrlrekes

SCOPe Domain Coordinates for d1p7ta_:

Click to download the PDB-style file with coordinates for d1p7ta_.
(The format of our PDB-style files is described here.)

Timeline for d1p7ta_: