SCOPe 2.07: Domain d1p7qd1: 1p7q D:4-97

Lineage for d1p7qd1 (1p7q D:4-97)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [49207] (5 PDB entries)
   Uniprot Q8NHL6 25-218

8. Domain d1p7qd1: 1p7q D:4-97 [94315]
   Other proteins in same PDB: d1p7qa1, d1p7qa2, d1p7qb_

Details for d1p7qd1

PDB Entry: 1p7q, 3.4 Å

PDB Description: Crystal Structure of HLA-A2 Bound to LIR-1, a Host and Viral MHC Receptor

PDB Compounds: (D:) leukocyte immunoglobulin-like receptor 1

SCOPe Domain Sequences for d1p7qd1:

Sequence, based on SEQRES records:

>d1p7qd1 b.1.1.4 (D:4-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
pkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktapwitripqelvkkgqfpip
sitwehagryrcyygsdtagrsessdplelvvtg

Sequence, based on observed residues (ATOM records):

>d1p7qd1 b.1.1.4 (D:4-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
pkptlwaepgsvitqgspvtlrcqtqeyrlyrekktapwitripqelvkkgqfpipsitw
ehagryrcyyrsessdplelvvtg

Timeline for d1p7qd1:

• d1p7qd1 first appeared in SCOP 1.67
  
• d1p7qd1 appears in SCOPe 2.06
  
• d1p7qd1 appears in the current release, SCOPe 2.08