Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (32 proteins) |
Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens) [TaxId:9606] [49207] (4 PDB entries) |
Domain d1p7qd1: 1p7q D:4-97 [94315] Other proteins in same PDB: d1p7qa1, d1p7qa2, d1p7qb_ |
PDB Entry: 1p7q (more details), 3.4 Å
SCOP Domain Sequences for d1p7qd1:
Sequence, based on SEQRES records: (download)
>d1p7qd1 b.1.1.4 (D:4-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens)} pkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktapwitripqelvkkgqfpip sitwehagryrcyygsdtagrsessdplelvvtg
>d1p7qd1 b.1.1.4 (D:4-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens)} pkptlwaepgsvitqgspvtlrcqtqeyrlyrekktapwitripqelvkkgqfpipsitw ehagryrcyyrsessdplelvvtg
Timeline for d1p7qd1: