SCOPe 2.07: Domain d1p7qa2: 1p7q A:1-181

Lineage for d1p7qa2 (1p7q A:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
   Uniprot P01892 25-298

8. Domain d1p7qa2: 1p7q A:1-181 [94313]
   Other proteins in same PDB: d1p7qa1, d1p7qb_, d1p7qd1, d1p7qd2

Details for d1p7qa2

PDB Entry: 1p7q, 3.4 Å

PDB Description: Crystal Structure of HLA-A2 Bound to LIR-1, a Host and Viral MHC Receptor

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d1p7qa2:

Sequence; same for both SEQRES and ATOM records:

>d1p7qa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1p7qa2:

• d1p7qa2 first appeared in SCOP 1.67
  
• d1p7qa2 appears in SCOPe 2.06
  
• d1p7qa2 appears in the current release, SCOPe 2.08