Lineage for d1p7qa2 (1p7q A:1-181)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501112Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 501113Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 501114Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 501142Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species)
  7. 501150Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (36 PDB entries)
  8. 501205Domain d1p7qa2: 1p7q A:1-181 [94313]
    Other proteins in same PDB: d1p7qa1, d1p7qb_, d1p7qd1, d1p7qd2

Details for d1p7qa2

PDB Entry: 1p7q (more details), 3.4 Å

PDB Description: Crystal Structure of HLA-A2 Bound to LIR-1, a Host and Viral MHC Receptor

SCOP Domain Sequences for d1p7qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7qa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOP Domain Coordinates for d1p7qa2:

Click to download the PDB-style file with coordinates for d1p7qa2.
(The format of our PDB-style files is described here.)

Timeline for d1p7qa2: