SCOP 1.69: Domain d1p7qa1: 1p7q A:182-276

Lineage for d1p7qa1 (1p7q A:182-276)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (70 PDB entries)

8. Domain d1p7qa1: 1p7q A:182-276 [94312]
   Other proteins in same PDB: d1p7qa2, d1p7qb_, d1p7qd1, d1p7qd2

Details for d1p7qa1

PDB Entry: 1p7q, 3.4 Å

PDB Description: Crystal Structure of HLA-A2 Bound to LIR-1, a Host and Viral MHC Receptor

SCOP Domain Sequences for d1p7qa1:

Sequence; same for both SEQRES and ATOM records:

>d1p7qa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep

Timeline for d1p7qa1:

• d1p7qa1 first appeared in SCOP 1.67
  
• d1p7qa1 appears in SCOP 1.71
  
• d1p7qa1 appears in the current release, SCOPe 2.08