SCOPe 2.06: Domain d1p7pa1: 1p7p A:389-548

Lineage for d1p7pa1 (1p7p A:389-548)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)

6. Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
   this domain follows the Rossmann-fold catalytic domain of class I aaRS

7. Species Escherichia coli [TaxId:562] [47327] (9 PDB entries)

8. Domain d1p7pa1: 1p7p A:389-548 [94309]
   Other proteins in same PDB: d1p7pa2, d1p7pa3
   protein/RNA complex; complexed with mph, zn

Details for d1p7pa1

PDB Entry: 1p7p, 1.8 Å

PDB Description: Methionyl-tRNA synthetase from Escherichia coli complexed with methionine phosphonate

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1p7pa1:

Sequence; same for both SEQRES and ATOM records:

>d1p7pa1 a.27.1.1 (A:389-548) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}
vvnlasrnagfinkrfdgvlaseladpqlyktftdaaevigeawesrefgkavreimala
dlanryvdeqapwvvakqegrdadlqaicsmginlfrvlmtylkpvlpklteraeaflnt
eltwdgiqqpllghkvnpfkalynridmrqvealveaske

Timeline for d1p7pa1:

• d1p7pa1 first appeared in SCOP 1.67
  
• d1p7pa1 appears in SCOPe 2.05
  
• d1p7pa1 appears in SCOPe 2.07
  
• d1p7pa1 appears in the current release, SCOPe 2.08