Lineage for d1p7pa1 (1p7p A:389-548)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266734Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1266735Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1266736Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins)
  6. 1266765Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species)
    this domain follows the Rossmann-fold catalytic domain of class I aaRS
  7. 1266766Species Escherichia coli [TaxId:562] [47327] (9 PDB entries)
  8. 1266770Domain d1p7pa1: 1p7p A:389-548 [94309]
    Other proteins in same PDB: d1p7pa2, d1p7pa3
    protein/RNA complex; complexed with mph, zn

Details for d1p7pa1

PDB Entry: 1p7p (more details), 1.8 Å

PDB Description: Methionyl-tRNA synthetase from Escherichia coli complexed with methionine phosphonate
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1p7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7pa1 a.27.1.1 (A:389-548) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}
vvnlasrnagfinkrfdgvlaseladpqlyktftdaaevigeawesrefgkavreimala
dlanryvdeqapwvvakqegrdadlqaicsmginlfrvlmtylkpvlpklteraeaflnt
eltwdgiqqpllghkvnpfkalynridmrqvealveaske

SCOPe Domain Coordinates for d1p7pa1:

Click to download the PDB-style file with coordinates for d1p7pa1.
(The format of our PDB-style files is described here.)

Timeline for d1p7pa1: