Lineage for d1p7lb2 (1p7l B:103-231)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582827Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)
  6. 2582828Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 2582829Species Escherichia coli [TaxId:562] [55976] (9 PDB entries)
  8. 2582864Domain d1p7lb2: 1p7l B:103-231 [94299]
    complexed with anp, k, met, mg, ppk, sam

Details for d1p7lb2

PDB Entry: 1p7l (more details), 2.5 Å

PDB Description: s-adenosylmethionine synthetase complexed with amppnp and met.
PDB Compounds: (B:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d1p7lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7lb2 d.130.1.1 (B:103-231) S-adenosylmethionine synthetase {Escherichia coli [TaxId: 562]}
nqgvdradpleqgagdqglmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrp
daksqvtfqyddgkivgidavvlstqhseeidqkslqeavmeeiikpilpaewltsatkf
finptgrfv

SCOPe Domain Coordinates for d1p7lb2:

Click to download the PDB-style file with coordinates for d1p7lb2.
(The format of our PDB-style files is described here.)

Timeline for d1p7lb2: