Lineage for d1p7ka2 (1p7k A:108-214)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549856Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
  8. 549869Domain d1p7ka2: 1p7k A:108-214 [94288]
    Other proteins in same PDB: d1p7ka1, d1p7kb1, d1p7kb2, d1p7kh1, d1p7kh2, d1p7kl1
    part of anti-ssDNA Fab
    complexed with 1pe, epe, gol, peg, so4

Details for d1p7ka2

PDB Entry: 1p7k (more details), 1.75 Å

PDB Description: Crystal structure of an anti-ssDNA antigen-binding fragment (Fab) bound to 4-(2-Hydroxyethyl)piperazine-1-ethanesulfonic acid (HEPES)
PDB Compounds: (A:)

SCOP Domain Sequences for d1p7ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7ka2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1p7ka2:

Click to download the PDB-style file with coordinates for d1p7ka2.
(The format of our PDB-style files is described here.)

Timeline for d1p7ka2: