SCOP 1.69: Domain d1p7ka1: 1p7k A:1-107

Lineage for d1p7ka1 (1p7k A:1-107)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (162 PDB entries)

8. Domain d1p7ka1: 1p7k A:1-107 [94287]
   Other proteins in same PDB: d1p7ka2, d1p7kb1, d1p7kb2, d1p7kh1, d1p7kh2, d1p7kl2
   part of anti-ssDNA Fab

Details for d1p7ka1

PDB Entry: 1p7k, 1.75 Å

PDB Description: Crystal structure of an anti-ssDNA antigen-binding fragment (Fab) bound to 4-(2-Hydroxyethyl)piperazine-1-ethanesulfonic acid (HEPES)

SCOP Domain Sequences for d1p7ka1:

Sequence; same for both SEQRES and ATOM records:

>d1p7ka1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelk

Timeline for d1p7ka1:

• d1p7ka1 first appeared in SCOP 1.67
  
• d1p7ka1 appears in SCOP 1.71
  
• d1p7ka1 appears in the current release, SCOPe 2.08