Lineage for d1p7id_ (1p7i D:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351237Superfamily a.4.1: Homeodomain-like [46689] (12 families) (S)
    consists only of helices
  5. 351238Family a.4.1.1: Homeodomain [46690] (22 proteins)
  6. 351247Protein Engrailed Homeodomain [46691] (1 species)
  7. 351248Species Drosophila melanogaster [TaxId:7227] [46692] (7 PDB entries)
  8. 351252Domain d1p7id_: 1p7i D: [94282]
    complexed with nhe; mutant

Details for d1p7id_

PDB Entry: 1p7i (more details), 2.1 Å

PDB Description: crystal structure of engrailed homeodomain mutant k52a

SCOP Domain Sequences for d1p7id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7id_ a.4.1.1 (D:) Engrailed Homeodomain {Drosophila melanogaster}
ekrprtafsseqlarlkrefnenrylterrrqqlsselglneaqikiwfqnaraki

SCOP Domain Coordinates for d1p7id_:

Click to download the PDB-style file with coordinates for d1p7id_.
(The format of our PDB-style files is described here.)

Timeline for d1p7id_: