| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins) subgroup of the larger IPT/TIG domain family |
| Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries) |
| Domain d1p7ho1: 1p7h O:576-678 [94277] Other proteins in same PDB: d1p7hl2, d1p7hm2, d1p7hn2, d1p7ho2 |
PDB Entry: 1p7h (more details), 2.6 Å
SCOP Domain Sequences for d1p7ho1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p7ho1 b.1.18.1 (O:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
Timeline for d1p7ho1: