| Class b: All beta proteins [48724] (174 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) ![]() |
| Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins) |
| Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries) |
| Domain d1p7hn2: 1p7h N:393-575 [94276] Other proteins in same PDB: d1p7hl1, d1p7hm1, d1p7hn1, d1p7ho1 |
PDB Entry: 1p7h (more details), 2.6 Å
SCOP Domain Sequences for d1p7hn2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p7hn2 b.2.5.3 (N:393-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenk
plglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmrat
idcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqr
sah
Timeline for d1p7hn2: