SCOP 1.73: Domain d1p7hn2: 1p7h N:393-575

Lineage for d1p7hn2 (1p7h N:393-575)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.5: p53-like transcription factors [49417] (7 families)
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)
Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)
Domain d1p7hn2: 1p7h N:393-575 [94276]
Other proteins in same PDB: d1p7hl1, d1p7hm1, d1p7hn1, d1p7ho1

Details for d1p7hn2

PDB Entry: 1p7h (more details), 2.6 Å

PDB Description: structure of nfat1 bound as a dimer to the hiv-1 ltr kb element

PDB Compounds: (N:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOP Domain Sequences for d1p7hn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7hn2 b.2.5.3 (N:393-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenk
plglqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmrat
idcagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqr
sah

SCOP Domain Coordinates for d1p7hn2:

Click to download the PDB-style file with coordinates for d1p7hn2.
(The format of our PDB-style files is described here.)

Timeline for d1p7hn2: