SCOPe 2.01: Domain d1p7hn1: 1p7h N:576-678

Lineage for d1p7hn1 (1p7h N:576-678)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)

8. Domain d1p7hn1: 1p7h N:576-678 [94275]
   Other proteins in same PDB: d1p7hl2, d1p7hm2, d1p7hn2, d1p7ho2
   protein/DNA complex

Details for d1p7hn1

PDB Entry: 1p7h, 2.6 Å

PDB Description: structure of nfat1 bound as a dimer to the hiv-1 ltr kb element

PDB Compounds: (N:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1p7hn1:

Sequence; same for both SEQRES and ATOM records:

>d1p7hn1 b.1.18.1 (N:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

Timeline for d1p7hn1:

• d1p7hn1 first appeared in SCOP 1.67
  
• d1p7hn1 appears in SCOP 1.75
  
• d1p7hn1 appears in SCOPe 2.02
  
• d1p7hn1 appears in the current release, SCOPe 2.08