SCOP 1.73: Domain d1p7hm1: 1p7h M:576-678

Lineage for d1p7hm1 (1p7h M:576-678)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (20 families)
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
subgroup of the larger IPT/TIG domain family
Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)
Domain d1p7hm1: 1p7h M:576-678 [94273]
Other proteins in same PDB: d1p7hl2, d1p7hm2, d1p7hn2, d1p7ho2

Details for d1p7hm1

PDB Entry: 1p7h (more details), 2.6 Å

PDB Description: structure of nfat1 bound as a dimer to the hiv-1 ltr kb element

PDB Compounds: (M:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOP Domain Sequences for d1p7hm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7hm1 b.1.18.1 (M:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOP Domain Coordinates for d1p7hm1:

Click to download the PDB-style file with coordinates for d1p7hm1.
(The format of our PDB-style files is described here.)

Timeline for d1p7hm1: