Lineage for d1p7gs2 (1p7g S:104-222)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503030Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 503031Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 503032Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 503060Protein Fe superoxide dismutase (FeSOD) [54725] (9 species)
  7. 503070Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [102926] (1 PDB entry)
  8. 503089Domain d1p7gs2: 1p7g S:104-222 [94260]
    Other proteins in same PDB: d1p7ga1, d1p7gb1, d1p7gc1, d1p7gd1, d1p7ge1, d1p7gf1, d1p7gg1, d1p7gh1, d1p7gi1, d1p7gj1, d1p7gk1, d1p7gl1, d1p7gm1, d1p7gn1, d1p7go1, d1p7gp1, d1p7gq1, d1p7gr1, d1p7gs1, d1p7gt1, d1p7gu1, d1p7gv1, d1p7gw1, d1p7gx1

Details for d1p7gs2

PDB Entry: 1p7g (more details), 1.8 Å

PDB Description: Crystal structure of superoxide dismutase from Pyrobaculum aerophilum

SCOP Domain Sequences for d1p7gs2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7gs2 d.44.1.1 (S:104-222) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum}
ggkpggkiadlinkffgsfekfkeefsqaaknvegvgwailvyepleeqllilqiekhnl
mhaadaqvllaldvwehayylqykndrgsyvdnwwnvvnwddverrlqkalngqialkl

SCOP Domain Coordinates for d1p7gs2:

Click to download the PDB-style file with coordinates for d1p7gs2.
(The format of our PDB-style files is described here.)

Timeline for d1p7gs2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p7gs1
View in 3D
Domains from other chains:
(mouse over for more information)
d1p7ga1, d1p7ga2, d1p7gb1, d1p7gb2, d1p7gc1, d1p7gc2, d1p7gd1, d1p7gd2, d1p7ge1, d1p7ge2, d1p7gf1, d1p7gf2, d1p7gg1, d1p7gg2, d1p7gh1, d1p7gh2, d1p7gi1, d1p7gi2, d1p7gj1, d1p7gj2, d1p7gk1, d1p7gk2, d1p7gl1, d1p7gl2, d1p7gm1, d1p7gm2, d1p7gn1, d1p7gn2, d1p7go1, d1p7go2, d1p7gp1, d1p7gp2, d1p7gq1, d1p7gq2, d1p7gr1, d1p7gr2, d1p7gt1, d1p7gt2, d1p7gu1, d1p7gu2, d1p7gv1, d1p7gv2, d1p7gw1, d1p7gw2, d1p7gx1, d1p7gx2