SCOP 1.67: Domain d1p7gp1: 1p7g P:12-103

Lineage for d1p7gp1 (1p7g P:12-103)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.2: Long alpha-hairpin [46556] (12 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Fe superoxide dismutase (FeSOD) [46611] (9 species)

7. Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [100984] (1 PDB entry)

8. Domain d1p7gp1: 1p7g P:12-103 [94253]
   Other proteins in same PDB: d1p7ga2, d1p7gb2, d1p7gc2, d1p7gd2, d1p7ge2, d1p7gf2, d1p7gg2, d1p7gh2, d1p7gi2, d1p7gj2, d1p7gk2, d1p7gl2, d1p7gm2, d1p7gn2, d1p7go2, d1p7gp2, d1p7gq2, d1p7gr2, d1p7gs2, d1p7gt2, d1p7gu2, d1p7gv2, d1p7gw2, d1p7gx2

Details for d1p7gp1

PDB Entry: 1p7g, 1.8 Å

PDB Description: Crystal structure of superoxide dismutase from Pyrobaculum aerophilum

SCOP Domain Sequences for d1p7gp1:

Sequence; same for both SEQRES and ATOM records:

>d1p7gp1 a.2.11.1 (P:12-103) Fe superoxide dismutase (FeSOD) {Archaeon Pyrobaculum aerophilum}
svttkrytlpplpyaynalepyisaeimqlhhqkhhqgyvnganaaleklekfrkgeaqi
diravlrdlsfhlnghilhsifwpnmappgkg

Timeline for d1p7gp1:

• d1p7gp1 is new in SCOP 1.67
  
• d1p7gp1 appears in SCOP 1.69
  
• d1p7gp1 appears in the current release, SCOPe 2.08