Lineage for d1p77a1 (1p77 A:102-272)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2093723Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 protein domains)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2093967Protein Shikimate 5-dehydrogenase AroE [89538] (6 species)
  7. 2093991Species Haemophilus influenzae [TaxId:727] [102173] (2 PDB entries)
  8. 2093992Domain d1p77a1: 1p77 A:102-272 [94214]
    Other proteins in same PDB: d1p77a2
    complexed with act, atr

Details for d1p77a1

PDB Entry: 1p77 (more details), 1.95 Å

PDB Description: crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
PDB Compounds: (A:) Shikimate 5-dehydrogenase

SCOPe Domain Sequences for d1p77a1:

Sequence, based on SEQRES records: (download)

>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]}
dgiglvtdlqrlnwlrpnqhvlilgaggatkgvllpllqaqqnivlanrtfsktkelaer
fqpygniqavsmdsiplqtydlvinatsaglsggtasvdaeilklgsafydmqyakgtdt
pfialckslgltnvsdgfgmlvaqaahsfhlwrgvmpdfvsvyeqlkkaml

Sequence, based on observed residues (ATOM records): (download)

>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]}
dgiglvtdlqrlnwlrpnqhvlilgaggatkgvllpllqaqqnivlanrtfsktkelaer
fqpygniqavsmdsiplqtydlvinatsasvdaeilklgsafydmqyakgtdtpfialck
slgltnvsdgfgmlvaqaahsfhlwrgvmpdfvsvyeqlkkaml

SCOPe Domain Coordinates for d1p77a1:

Click to download the PDB-style file with coordinates for d1p77a1.
(The format of our PDB-style files is described here.)

Timeline for d1p77a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p77a2