Lineage for d1p75b1 (1p75 B:23-352)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123674Protein Thymidine kinase [52552] (4 species)
    contains insert all-alpha subdomain, res. 251-322
  7. 2123675Species Equine herpesvirus type 4 [TaxId:10331] [102340] (4 PDB entries)
  8. 2123685Domain d1p75b1: 1p75 B:23-352 [94211]
    Other proteins in same PDB: d1p75a2, d1p75b2, d1p75c2, d1p75d2
    complexed with so4, t5a

Details for d1p75b1

PDB Entry: 1p75 (more details), 3.02 Å

PDB Description: Crystal structure of EHV4-TK complexed with TP5A
PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d1p75b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p75b1 c.37.1.1 (B:23-352) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}
vtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiydtqn
rkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdrhpv
astvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrarigeq
iditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqervspe
lgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavvesl
lplmsstlsdfdsasaleraartfnaemgv

SCOPe Domain Coordinates for d1p75b1:

Click to download the PDB-style file with coordinates for d1p75b1.
(The format of our PDB-style files is described here.)

Timeline for d1p75b1: