SCOPe 2.06: Domain d1p75b1: 1p75 B:23-352

Lineage for d1p75b1 (1p75 B:23-352)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Thymidine kinase [52552] (4 species)
   contains insert all-alpha subdomain, res. 251-322

7. Species Equine herpesvirus type 4 [TaxId:10331] [102340] (4 PDB entries)

8. Domain d1p75b1: 1p75 B:23-352 [94211]
   Other proteins in same PDB: d1p75a2, d1p75b2, d1p75c2, d1p75d2
   complexed with so4, t5a

Details for d1p75b1

PDB Entry: 1p75, 3.02 Å

PDB Description: Crystal structure of EHV4-TK complexed with TP5A

PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d1p75b1:

Sequence; same for both SEQRES and ATOM records:

>d1p75b1 c.37.1.1 (B:23-352) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}
vtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiydtqn
rkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdrhpv
astvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrarigeq
iditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqervspe
lgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavvesl
lplmsstlsdfdsasaleraartfnaemgv

Timeline for d1p75b1:

• d1p75b1 first appeared in SCOP 1.67, called d1p75b_
  
• d1p75b1 was called d1p75b_ in SCOPe 2.05
  
• d1p75b1 appears in SCOPe 2.07
  
• d1p75b1 appears in the current release, SCOPe 2.08