Lineage for d1p74b2 (1p74 B:1-101)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489479Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 489480Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 489695Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 489704Protein Shikimate 5-dehydrogenase AroE [89584] (3 species)
  7. 489713Species Haemophilus influenzae [TaxId:727] [102224] (2 PDB entries)
  8. 489716Domain d1p74b2: 1p74 B:1-101 [94209]
    Other proteins in same PDB: d1p74a1, d1p74b1

Details for d1p74b2

PDB Entry: 1p74 (more details), 2.4 Å

PDB Description: crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae

SCOP Domain Sequences for d1p74b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p74b2 c.58.1.5 (B:1-101) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae}
mdlyavwgnpiaqskspliqnklaaqthqtmeyiaklgdldafeqqllaffeegakgcni
tspfkerayqladeysqraklaeacntlkklddgklyadnt

SCOP Domain Coordinates for d1p74b2:

Click to download the PDB-style file with coordinates for d1p74b2.
(The format of our PDB-style files is described here.)

Timeline for d1p74b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p74b1