Lineage for d1p73a1 (1p73 A:23-352)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109585Protein Thymidine kinase [52552] (4 species)
    contains insert all-alpha subdomain, res. 251-322
  7. 2109586Species Equine herpesvirus type 4 [TaxId:10331] [102340] (4 PDB entries)
  8. 2109591Domain d1p73a1: 1p73 A:23-352 [94202]
    Other proteins in same PDB: d1p73a2, d1p73b2, d1p73c2, d1p73d2
    complexed with 4ta, so4

Details for d1p73a1

PDB Entry: 1p73 (more details), 2.7 Å

PDB Description: Crystal structure of EHV4-TK complexed with TP4A
PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d1p73a1:

Sequence, based on SEQRES records: (download)

>d1p73a1 c.37.1.1 (A:23-352) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}
vtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiydtqn
rkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdrhpv
astvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrarigeq
iditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqervspe
lgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavvesl
lplmsstlsdfdsasaleraartfnaemgv

Sequence, based on observed residues (ATOM records): (download)

>d1p73a1 c.37.1.1 (A:23-352) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}
vtivriyldgvygigksttgrvmassptlyfpepmaywrtlfetdvisgiydtqnrkvdd
aalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdrhpvastvcfpaary
llgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrarigeqiditliatlrn
vyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqervspelgdtlfalfkt
qellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavvesllplmsstlsdf
dsasaleraartfnaemgv

SCOPe Domain Coordinates for d1p73a1:

Click to download the PDB-style file with coordinates for d1p73a1.
(The format of our PDB-style files is described here.)

Timeline for d1p73a1: