Lineage for d1p6xb1 (1p6x B:23-351)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2473889Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2474274Protein Thymidine kinase [52552] (4 species)
    contains insert all-alpha subdomain, res. 251-322
  7. 2474275Species Equine herpesvirus type 4 [TaxId:10331] [102340] (4 PDB entries)
  8. 2474277Domain d1p6xb1: 1p6x B:23-351 [94196]
    Other proteins in same PDB: d1p6xa2, d1p6xb2
    complexed with so4, thm

Details for d1p6xb1

PDB Entry: 1p6x (more details), 2 Å

PDB Description: Crystal structure of EHV4-TK complexed with Thy and SO4
PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d1p6xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6xb1 c.37.1.1 (B:23-351) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}
vtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiydtqn
rkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdrhpv
astvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrarigeq
iditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqervspe
lgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavvesl
lplmsstlsdfdsasaleraartfnaemg

SCOPe Domain Coordinates for d1p6xb1:

Click to download the PDB-style file with coordinates for d1p6xb1.
(The format of our PDB-style files is described here.)

Timeline for d1p6xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p6xb2