Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
Protein Thymidine kinase [52552] (4 species) contains insert all-alpha subdomain, res. 251-322 |
Species Equine herpesvirus type 4 [TaxId:10331] [102340] (4 PDB entries) |
Domain d1p6xb1: 1p6x B:23-351 [94196] Other proteins in same PDB: d1p6xa2, d1p6xb2 complexed with so4, thm |
PDB Entry: 1p6x (more details), 2 Å
SCOPe Domain Sequences for d1p6xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p6xb1 c.37.1.1 (B:23-351) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} vtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiydtqn rkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdrhpv astvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrarigeq iditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqervspe lgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavvesl lplmsstlsdfdsasaleraartfnaemg
Timeline for d1p6xb1: