SCOPe 2.05: Domain d1p6xa_: 1p6x A:

Lineage for d1p6xa_ (1p6x A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Thymidine kinase [52552] (3 species)
   contains insert all-alpha subdomain, res. 251-322

7. Species Equine herpesvirus type 4 [TaxId:10331] [102340] (4 PDB entries)

8. Domain d1p6xa_: 1p6x A: [94195]
   complexed with so4, thm

Details for d1p6xa_

PDB Entry: 1p6x, 2 Å

PDB Description: Crystal structure of EHV4-TK complexed with Thy and SO4

PDB Compounds: (A:) Thymidine kinase

SCOPe Domain Sequences for d1p6xa_:

Sequence; same for both SEQRES and ATOM records:

>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}
shmvtivriyldgvygigksttgrvmasaasggsptlyfpepmaywrtlfetdvisgiyd
tqnrkqqgnlavddaalitahyqsrfttpylilhdhtctlfggnslqrgtqpdltlvfdr
hpvastvcfpaaryllgdmsmcalmamvatlprepqggnivvttlnveehirrlrtrari
geqiditliatlrnvyfmlvntchflrsgrvwrdgwgelptscgaykhratqmdafqerv
spelgdtlfalfktqellddrgvilevhawaldalmlklrnlnvfsadlsgtprqcaavv
esllplmsstlsdfdsasaleraartfnaemgv

Timeline for d1p6xa_:

• d1p6xa_ first appeared in SCOP 1.67
  
• d1p6xa_ appears in SCOPe 2.04
  
• d1p6xa_ is called d1p6xa1 in SCOPe 2.06
  
• d1p6xa_ appears in the current release, SCOPe 2.08, called d1p6xa1