Lineage for d1p6wa2 (1p6w A:1-347)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818157Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1818617Protein Plant alpha-amylase [51474] (2 species)
  7. 1818618Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89465] (7 PDB entries)
  8. 1818624Domain d1p6wa2: 1p6w A:1-347 [94194]
    Other proteins in same PDB: d1p6wa1
    complexed with bgc, ca, glc, gtm, sgc

Details for d1p6wa2

PDB Entry: 1p6w (more details), 2 Å

PDB Description: crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with the substrate analogue, methyl 4i,4ii,4iii-tri- thiomaltotetraoside (thio-dp4)
PDB Compounds: (A:) PROTEIN (Alpha-amylase type A isozyme)

SCOPe Domain Sequences for d1p6wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6wa2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]}
hqvlfqgfnweswkqsggwynmmmgkvddiaaagvthvwlpppshsvsnegympgrlydi
daskygnaaelksligalhgkgvqaiadivinhrcadykdsrgiycifeggtsdgrldwg
phmicrddtkysdgtanldtgadfaaapdidhlndrvqrelkewllwlksdlgfdawrld
fargyspemakvyidgtspslavaevwdnmatggdgkpnydqdahrqnlvnwvdkvggaa
sagmvfdfttkgilnaavegelwrlidpqgkapgvmgwwpakavtfvdnhdtgstqamwp
fpsdkvmqgyayilthpgipcifydhffnwgfkdqiaalvairkrng

SCOPe Domain Coordinates for d1p6wa2:

Click to download the PDB-style file with coordinates for d1p6wa2.
(The format of our PDB-style files is described here.)

Timeline for d1p6wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p6wa1