Lineage for d1p6wa1 (1p6w A:348-404)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380059Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 380060Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 380061Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 380324Protein Plant alpha-amylase [51040] (2 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 380325Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89384] (2 PDB entries)
  8. 380327Domain d1p6wa1: 1p6w A:348-404 [94193]
    Other proteins in same PDB: d1p6wa2
    complexed with ca, glc, gsd, ma3

Details for d1p6wa1

PDB Entry: 1p6w (more details), 2 Å

PDB Description: crystal structure of barley alpha-amylase isozyme 1 (amy1) in complex with the substrate analogue, methyl 4i,4ii,4iii-tri- thiomaltotetraoside (thio-dp4)

SCOP Domain Sequences for d1p6wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6wa1 b.71.1.1 (A:348-404) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme}
itatsalkilmhegdayvaeidgkvvvkigsrydvgavipagfvtsahgndyavwek

SCOP Domain Coordinates for d1p6wa1:

Click to download the PDB-style file with coordinates for d1p6wa1.
(The format of our PDB-style files is described here.)

Timeline for d1p6wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p6wa2