SCOP 1.71: Domain d1p6vc_: 1p6v C:

Lineage for d1p6vc_ (1p6v C:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.111: Small protein B (SmpB) [74981] (1 superfamily)
   barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold

4. Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family)

5. Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)

6. Protein Small protein B (SmpB) [74984] (2 species)
   tmRNA-binding protein; SsrA-binding protein

7. Species Aquifex aeolicus [TaxId:63363] [74985] (2 PDB entries)

8. Domain d1p6vc_: 1p6v C: [94192]
   complexed with tRNA domain of tmRNA

Details for d1p6vc_

PDB Entry: 1p6v, 3.2 Å

PDB Description: Crystal structure of the tRNA domain of transfer-messenger RNA in complex with SmpB

SCOP Domain Sequences for d1p6vc_:

Sequence, based on SEQRES records:

>d1p6vc_ b.111.1.1 (C:) Small protein B (SmpB) {Aquifex aeolicus}
sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
nlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkvli
alakgkkl

Sequence, based on observed residues (ATOM records):

>d1p6vc_ b.111.1.1 (C:) Small protein B (SmpB) {Aquifex aeolicus}
sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
nlyiapykhanhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkvliala
kgkkl

Timeline for d1p6vc_:

• d1p6vc_ first appeared in SCOP 1.67
  
• d1p6vc_ appears in SCOP 1.69
  
• d1p6vc_ appears in SCOP 1.73
  
• d1p6vc_ appears in the current release, SCOPe 2.08