Lineage for d1p6vc_ (1p6v C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075123Fold b.111: Small protein B (SmpB) [74981] (1 superfamily)
    barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold
  4. 2075124Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) (S)
  5. 2075125Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)
  6. 2075126Protein Small protein B (SmpB) [74984] (2 species)
    tmRNA-binding protein; SsrA-binding protein
  7. 2075127Species Aquifex aeolicus [TaxId:63363] [74985] (2 PDB entries)
  8. 2075129Domain d1p6vc_: 1p6v C: [94192]
    complexed with tRNA domain of tmRNA
    protein/RNA complex

Details for d1p6vc_

PDB Entry: 1p6v (more details), 3.2 Å

PDB Description: Crystal structure of the tRNA domain of transfer-messenger RNA in complex with SmpB
PDB Compounds: (C:) SsrA-binding protein

SCOPe Domain Sequences for d1p6vc_:

Sequence, based on SEQRES records: (download)

>d1p6vc_ b.111.1.1 (C:) Small protein B (SmpB) {Aquifex aeolicus [TaxId: 63363]}
sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
nlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkvli
alakgkkl

Sequence, based on observed residues (ATOM records): (download)

>d1p6vc_ b.111.1.1 (C:) Small protein B (SmpB) {Aquifex aeolicus [TaxId: 63363]}
sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
nlyiapykhanhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkvliala
kgkkl

SCOPe Domain Coordinates for d1p6vc_:

Click to download the PDB-style file with coordinates for d1p6vc_.
(The format of our PDB-style files is described here.)

Timeline for d1p6vc_: