Lineage for d1p6va_ (1p6v A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 569001Fold b.111: Small protein B (SmpB) [74981] (1 superfamily)
    barrel, closed; n=6, S=8, greek-key, partial similarity to the OB-fold
  4. 569002Superfamily b.111.1: Small protein B (SmpB) [74982] (1 family) (S)
  5. 569003Family b.111.1.1: Small protein B (SmpB) [74983] (1 protein)
  6. 569004Protein Small protein B (SmpB) [74984] (2 species)
    tmRNA-binding protein; SsrA-binding protein
  7. 569005Species Aquifex aeolicus [TaxId:63363] [74985] (2 PDB entries)
  8. 569006Domain d1p6va_: 1p6v A: [94191]

Details for d1p6va_

PDB Entry: 1p6v (more details), 3.2 Å

PDB Description: Crystal structure of the tRNA domain of transfer-messenger RNA in complex with SmpB

SCOP Domain Sequences for d1p6va_:

Sequence, based on SEQRES records: (download)

>d1p6va_ b.111.1.1 (A:) Small protein B (SmpB) {Aquifex aeolicus}
sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
nlyiapykhatienhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkvli
alakgkkl

Sequence, based on observed residues (ATOM records): (download)

>d1p6va_ b.111.1.1 (A:) Small protein B (SmpB) {Aquifex aeolicus}
sdkiipiaenkeakakydiletyeagivlkgsevkslrekgtvsfkdsfvriengeawly
nlyiapykhanhdplrkrklllhkreimrlygkvqekgytiiplklywknnkvkvliala
kgkkl

SCOP Domain Coordinates for d1p6va_:

Click to download the PDB-style file with coordinates for d1p6va_.
(The format of our PDB-style files is described here.)

Timeline for d1p6va_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p6vc_