Lineage for d1p6ua_ (1p6u A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2463696Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2463707Protein CheY protein [52174] (5 species)
  7. 2463802Species Sinorhizobium meliloti, CheY2 [TaxId:382] [102225] (2 PDB entries)
    Uniprot Q52884
  8. 2463804Domain d1p6ua_: 1p6u A: [94190]

Details for d1p6ua_

PDB Entry: 1p6u (more details)

PDB Description: nmr structure of the bef3-activated structure of the response regulator chey2-mg2+ from sinorhizobium meliloti
PDB Compounds: (A:) CheY2

SCOPe Domain Sequences for d1p6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6ua_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]}
mslaekikvlivddqvtsrlllgdalqqlgfkqitaagdgeqgmkimaqnphhlvisdfn
mpkmdglgllqavranpatkkaafiiltaqgdralvqkaaalgannvlakpftiekmkaa
ieavfgalk

SCOPe Domain Coordinates for d1p6ua_:

Click to download the PDB-style file with coordinates for d1p6ua_.
(The format of our PDB-style files is described here.)

Timeline for d1p6ua_: