![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein CheY protein [52174] (5 species) |
![]() | Species Sinorhizobium meliloti, CheY2 [TaxId:382] [102225] (2 PDB entries) Uniprot Q52884 |
![]() | Domain d1p6ua_: 1p6u A: [94190] |
PDB Entry: 1p6u (more details)
SCOPe Domain Sequences for d1p6ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p6ua_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} mslaekikvlivddqvtsrlllgdalqqlgfkqitaagdgeqgmkimaqnphhlvisdfn mpkmdglgllqavranpatkkaafiiltaqgdralvqkaaalgannvlakpftiekmkaa ieavfgalk
Timeline for d1p6ua_: