SCOPe 2.06: Domain d1p6ua_: 1p6u A:

Lineage for d1p6ua_ (1p6u A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Sinorhizobium meliloti, CheY2 [TaxId:382] [102225] (2 PDB entries)
   Uniprot Q52884

8. Domain d1p6ua_: 1p6u A: [94190]

Details for d1p6ua_

PDB Entry: 1p6u

PDB Description: nmr structure of the bef3-activated structure of the response regulator chey2-mg2+ from sinorhizobium meliloti

PDB Compounds: (A:) CheY2

SCOPe Domain Sequences for d1p6ua_:

Sequence; same for both SEQRES and ATOM records:

>d1p6ua_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]}
mslaekikvlivddqvtsrlllgdalqqlgfkqitaagdgeqgmkimaqnphhlvisdfn
mpkmdglgllqavranpatkkaafiiltaqgdralvqkaaalgannvlakpftiekmkaa
ieavfgalk

Timeline for d1p6ua_:

• d1p6ua_ first appeared in SCOP 1.67
  
• d1p6ua_ appears in SCOPe 2.05
  
• d1p6ua_ appears in SCOPe 2.07
  
• d1p6ua_ appears in the current release, SCOPe 2.08