Lineage for d1p6ua_ (1p6u A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481070Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 481071Family c.23.1.1: CheY-related [52173] (17 proteins)
  6. 481079Protein CheY protein [52174] (4 species)
  7. 481135Species Sinorhizobium meliloti, CheY2 [TaxId:382] [102225] (2 PDB entries)
  8. 481137Domain d1p6ua_: 1p6u A: [94190]

Details for d1p6ua_

PDB Entry: 1p6u (more details)

PDB Description: nmr structure of the bef3-activated structure of the response regulator chey2-mg2+ from sinorhizobium meliloti

SCOP Domain Sequences for d1p6ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p6ua_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2}
mslaekikvlivddqvtsrlllgdalqqlgfkqitaagdgeqgmkimaqnphhlvisdfn
mpkmdglgllqavranpatkkaafiiltaqgdralvqkaaalgannvlakpftiekmkaa
ieavfgalk

SCOP Domain Coordinates for d1p6ua_:

Click to download the PDB-style file with coordinates for d1p6ua_.
(The format of our PDB-style files is described here.)

Timeline for d1p6ua_: